PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_04039
Common NameKK1_004135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 231aa    MW: 26337.1 Da    PI: 9.8491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_04039genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT++Ed++l ++++++G+g+W+  ++  g++R++k+c++rw++yl
    C.cajan_04039 14 RGVWTAQEDKILSEYIRLHGKGRWRNLPKSAGLKRCGKSCRLRWLNYL 61
                     899*******************************************97 PP

2Myb_DNA-binding513.4e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++
    C.cajan_04039  67 RGNISSDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNS 110
                      78999*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.528961IPR017930Myb domain
SuperFamilySSF466894.49E-2812108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
CDDcd001673.82E-101761No hitNo description
PROSITE profilePS5129425.11462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2465116IPR009057Homeodomain-like
SMARTSM007174.1E-1566114IPR001005SANT/Myb domain
PfamPF002494.3E-1467110IPR001005SANT/Myb domain
CDDcd001671.28E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGSSLCCSKE SLNRGVWTAQ EDKILSEYIR LHGKGRWRNL PKSAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SSDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS KLRKKVKNEE  120
QTSISGPKNP TKLQEAPVAT PHVVRTKARK CSKALFINPA MQVPNSSKAV AEEEATRVVD  180
DVSNQIKYDN GFLSFSNDSK DLLMEFNVGD VCLSDLLNLD FSDTYDFTYL R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541301.11e-109PREDICTED: transcription factor MYB23-like
SwissprotQ9FJA24e-63TT2_ARATH; Transcription factor TT2
TrEMBLA0A151SSN61e-172A0A151SSN6_CAJCA; Transcription factor TT2
STRINGGLYMA13G16890.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-64MYB family protein